PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02920g02049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family MYB
Protein Properties Length: 209aa    MW: 24746.7 Da    PI: 9.6288
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02920g02049.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-18449147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              rg W + Ede+l ++v+++G+++W++Ia+ ++ gR++k+c++rw++ 
  Peinf101Scf02920g02049.1  4 RGHWRPHEDEKLQELVAKYGPHNWNAIAENLQ-GRSGKSCRLRWYNQ 49
                              899*****************************.************96 PP

2Myb_DNA-binding54.82.1e-175699146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Peinf101Scf02920g02049.1 56 RSPFTEEEEERLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                              789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.791150IPR017930Myb domain
SMARTSM007174.9E-16352IPR001005SANT/Myb domain
SuperFamilySSF466891.57E-29497IPR009057Homeodomain-like
PfamPF002492.0E-17450IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-27557IPR009057Homeodomain-like
CDDcd001673.71E-14748No hitNo description
PROSITE profilePS5129426.11251105IPR017930Myb domain
SMARTSM007172.4E-1555103IPR001005SANT/Myb domain
PfamPF002493.4E-145698IPR001005SANT/Myb domain
CDDcd001672.65E-115898No hitNo description
Gene3DG3DSA:1.10.10.605.0E-2158104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MCSRGHWRPH EDEKLQELVA KYGPHNWNAI AENLQGRSGK SCRLRWYNQL DPRINRSPFT  60
EEEEERLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MSRRCRERSK IYSMRNINNA  120
AQKSLTSQQD TSQNQDDNIQ DIRRGSSNMN SIDQQFLERF NYYPNFTFNN SLYPKELHFD  180
HLRHHLKINE GIYTHETAQP GVLLSVAIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-3541057108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-66HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755151e-66HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616250.11e-108PREDICTED: transcriptional activator Myb-like
RefseqXP_016466774.11e-108PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0H4CRL48e-83A0A0H4CRL4_BETPL; MYB transcription factor 3
STRINGPGSC0003DMT4000797143e-80(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.18e-71myb domain protein 52